
Cell Line Lysates
- (1)
- (1)
- (100)
- (2)
- (43)
- (26)
- (2)
- (1)
- (2)
- (1)
- (7)
- (3)
- (4)
- (8)
- (3)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (2)
- (5)
- (8)
- (1)
- (15)
- (11)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (3)
- (2)
- (1)
- (1)
- (6)
- (2)
- (1)
- (1)
- (2)
- (3)
- (1)
- (17)
- (2)
- (14)
- (16)
Filtered Search Results

A-431 (human epidermoid carcinoma) Nuclear extract lysate, Non-denatured; Abnova
Non-denatured nuclear extract lysate of A-431 (human epidermoid carcinoma)
Gibco™ Rat BSEP Vesicles
Rat BSEP Vesicles are insect-derived purified plasma membranes with inserted BSEP transport protein (bile salt export pump, ABCB11).

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Gibco™ Human MRP8 Vesicles
Human MRP8 Vesicles are insect derived purified plasma membranes with inserted MRP8 transport protein (Multidrug Resistance-associated Protein 8, ABCC11).

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human DNAJB4 (aa 274-337) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human DNAJB4 (aa 274-337) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human TACC2 (aa 886-979) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | NLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human TACC2 (aa 886-979) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ADCK4 (aa 180-240) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ADCK4 (aa 180-240) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MSL1 (aa 335-432) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MSL1 (aa 335-432) Control Fragment |
Recombinant | Recombinant |
Compass Biomedical™ Gamma Irradiated PLUS™ Human Platelet Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Advanced human platelet lysate that is safe and consistent for the rapid expansion of human mesenchymal cell cultures.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Compass Biomedical™ GMP PLUS™ Human Platelet Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Advanced human platelet lysate that is safe and consistent for the rapid expansion of human mesenchymal cell cultures.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at -80°C upon receipt. Thaw at room temperature or in a water bath. After thawing, aliquot and store at -20°C or colder. Long term storage at -80°C is recommended. Multiple freeze/thaw cycles are not recommended. |
---|---|
Format | Bottle |
Host Species | Human |
Product Type | Human Platelet Lysate |
Purity | GMP Grade |
Research Category | GMP |
For Use With (Application) | Cell Culture, Stem Cell Culture |
Compass Biomedical™ R&D PLUS™ Human Platelet Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Advanced human platelet lysate that is safe and consistent for the rapid expansion of human mesenchymal cell cultures.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at -80°C upon receipt. Thaw at room temperature or in a water bath. After thawing, aliquot and store at -20°C or colder. Long term storage at -80°C is recommended. Multiple freeze/thaw cycles are not recommended. |
---|---|
Format | Bottle |
Host Species | Human |
Product Type | Human Platelet Lysate |
Research Category | RD |
For Use With (Application) | Cell Culture, Stem Cell Culture |